PRKCG Antibody - middle region : Biotin

PRKCG Antibody - middle region : Biotin
Artikelnummer
AVIARP56426_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in d

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRKCG

Key Reference: Wieczorek,S., (2007) Mov. Disord. 22 (14), 2135-2136

Molecular Weight: 78kDa

Peptide Sequence: Synthetic peptide located within the following region: WSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein kinase C gamma type

Protein Size: 697

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56426_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56426_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5582
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×