English
PRKCG Antibody - N-terminal region : HRP
PRKCG Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56425_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in d
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKCG
Key Reference: Wieczorek,S., (2007) Mov. Disord. 22 (14), 2135-2136
Molecular Weight: 78kDa
Peptide Sequence: Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Protein kinase C gamma type
Protein Size: 697
Purification: Affinity Purified
Description of Target: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in d
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKCG
Key Reference: Wieczorek,S., (2007) Mov. Disord. 22 (14), 2135-2136
Molecular Weight: 78kDa
Peptide Sequence: Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Protein kinase C gamma type
Protein Size: 697
Purification: Affinity Purified
| Artikelnummer | AVIARP56425_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP56425_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting, Chromatin Immunoprecipitation (ChIP) |
| Human Gene ID | 5582 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
