PRL Antibody

Uniprot: P01236

Gene Name: PRL

Immunogen: Recombinant human PRL

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 60%

Core Sequence: LATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETK

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 60%, Rat - 62%, Pig - 77%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Prolactin; PRL

Protein name: Prolactin

Product panel: IHC Pathology

Clone No.: KAA114_11E11

Antigen Species: Human

Target Name: PRL

IHC Verification: -

IHC Dilution: N/A

WB Verification: -

WB Dilution: N/A

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: succeed

Sandwich ELISA Dilution: 1:250~1:500

Antigen ID: PP-059

Cross reactivity: Not tested

• Artikelnummer: ASBKC-1035-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: KC-1035-100
• Verpackungseinheit: 100 μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: ELISA
• Isotyp: IgG2b
• Human Gene ID: 5617
• Wirt: Mouse
• Konjugat: Unconjugated