English
PRR5 Antibody - N-terminal region : HRP
PRR5 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56749_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: This gene encodes a protein with a proline-rich domain. This gene is located in a region of chromosome 22 reported to contain a tumor suppressor gene that may be involved in breast and colorectal tumorigenesis. Rare read-through transcripts, containing exons from the ARHGAP8 gene which is located immediately downstream, led to the original description of PRR5 and ARHGAP8 as a single gene. Alternative splicing and the use of alternative promoters results in transcripts encoding different isoforms.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRR5
Molecular Weight: 41kDa
Peptide Sequence: Synthetic peptide located within the following region: NSIHNGVIAVFQRKGLPDQELFSLNEGVRQLLKTELGSFFTEYLQNQLLT
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: cDNA FLJ34565 fis, clone KIDNE2006210, highly similar to Homo sapiens proline rich protein 5 (PRR5), transcript variant 1, mRNA EMBL BAG52436.1
Protein Size: 379
Purification: Affinity Purified
Description of Target: This gene encodes a protein with a proline-rich domain. This gene is located in a region of chromosome 22 reported to contain a tumor suppressor gene that may be involved in breast and colorectal tumorigenesis. Rare read-through transcripts, containing exons from the ARHGAP8 gene which is located immediately downstream, led to the original description of PRR5 and ARHGAP8 as a single gene. Alternative splicing and the use of alternative promoters results in transcripts encoding different isoforms.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRR5
Molecular Weight: 41kDa
Peptide Sequence: Synthetic peptide located within the following region: NSIHNGVIAVFQRKGLPDQELFSLNEGVRQLLKTELGSFFTEYLQNQLLT
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: cDNA FLJ34565 fis, clone KIDNE2006210, highly similar to Homo sapiens proline rich protein 5 (PRR5), transcript variant 1, mRNA EMBL BAG52436.1
Protein Size: 379
Purification: Affinity Purified
| Artikelnummer | AVIARP56749_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP56749_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 55615 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
