PXT1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of PXT1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PXT1

Key Reference: Grzmil,P., Cytogenet. Genome Res. 119 (1-2), 74-82 (2007)

Molecular Weight: 6kDa

Peptide Sequence: Synthetic peptide located within the following region: MQLRHIGDNIDHRMVREDLQQDGRDALDHFVFFFFRRVQVLLHFFWNNHL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peroxisomal testis-specific protein 1

Protein Size: 51

Purification: Affinity Purified

• Artikelnummer: AVIARP55566_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55566_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 222659
• Wirt: Rabbit