RAB11FIP2 Antibody - N-terminal region : HRP

RAB11FIP2 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55095_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RAB11FIP2 is a Rab11 effector protein acting in the regulation of the transport of vesicles from the endosomal recycling compartment (ERC) to the plasma membrane.RAB11FIP2 is also involved in receptor-mediated endocytosis and membrane trafficking of recycling endosomes, probably originating from clathrin-coated vesicles. Binds preferentially to phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and phosphatidic acid (PA).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB11FIP2

Molecular Weight: 58

Peptide Sequence: Synthetic peptide located within the following region: LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Rab11 family-interacting protein 2

Protein Size: 512

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55095_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55095_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22841
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×