Rab23 Antibody - middle region : FITC

Rab23 Antibody - middle region : FITC
Artikelnummer
AVIARP56871_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: DPEQTHSSSNKIGVFNASVRSHLGQNSSSLNGGDVINLRPNKQRTKRTRN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-23

Protein Size: 237

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56871_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56871_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 19335
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×