RAB37 Antibody - middle region : HRP

RAB37 Antibody - middle region : HRP
Artikelnummer
AVIARP55738_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rab proteins are low molecular mass GTPases that are critical regulators of vesicle trafficking. For additional background information on Rab proteins, see MIM 179508.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB37

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: ERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein Rab-37

Protein Size: 216

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55738_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55738_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 326624
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×