RAB40C Antibody - C-terminal region : HRP

RAB40C Antibody - C-terminal region : HRP
Artikelnummer
AVIARP57520_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RAB40C is a probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB40C

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: MANGMNAVMMHGRSYSLASGAGGGGSKGNSLKRSKSIRPPQSPPQNCSRS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein Rab-40C

Protein Size: 281

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57520_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57520_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57799
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×