RAD23B Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER). This protein was found to be a component of the protein complex that specifically complements the

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAD23B

Key Reference: Lin,J., (2007) Cancer Epidemiol. Biomarkers Prev. 16 (10), 2065-2071

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: QMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: UV excision repair protein RAD23 homolog B

Protein Size: 409

Purification: Affinity Purified

• Artikelnummer: AVIARP56506_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56506_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 5887
• Wirt: Rabbit