RAGE Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: RAGE is able to phosphorylate several exogenous substrates and to undergo autophosphorylation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAGE

Key Reference: Luo,H.R., (2001) Neuron 31 (3), 439-451

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: MKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICEL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: MAPK/MAK/MRK overlapping kinase

Protein Size: 419

Purification: Affinity Purified

• Artikelnummer: AVIARP56743_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56743_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5891
• Wirt: Rabbit