RAI14 Antibody - middle region : Biotin

RAI14 Antibody - middle region : Biotin
Artikelnummer
AVIARP55286_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: RAI14 contains 7 ANK repeats. The function of RAI14 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAI14

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 110kDa

Peptide Sequence: Synthetic peptide located within the following region: ELSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQLTNVSRAKAE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ankycorbin

Protein Size: 980

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55286_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55286_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26064
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×