RALGDS Antibody - N-terminal region : Biotin

RALGDS Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56275_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RALGDS

Key Reference: Omholt,K. (2007) Melanoma Res. 17 (6), 410-412

Molecular Weight: 95kDa

Peptide Sequence: Synthetic peptide located within the following region: KRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSED

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ral guanine nucleotide dissociation stimulator

Protein Size: 859

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56275_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56275_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5900
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×