RALGPS2 Antibody - N-terminal region : Biotin

RALGPS2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57091_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: RALGPS2 is a guanine nucleotide exchange factor for the small GTPase RALA. RALGPS2 may be involved in cytoskeletal organization. RALGPS2 may also be involved in the stimulation of transcription in a Ras-independent fashion.

Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human RALGPS2

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: MDLMNGQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-specific guanine nucleotide-releasing factor RalGPS2

Protein Size: 279

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57091_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57091_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55103
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×