RASGEF1A Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RASGEF1A is the guanine nucleotide exchange factor (GEF) for KRAS, HRAS, and NRAS (in vitro). It plays a role in cell migration.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RASGEF1A

Key Reference: Burzynski,G.M., (2005) Am. J. Hum. Genet. 76 (5), 850-858

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: TFLLSSRVFMPPHDLLARVGQICVEQKQQLEAGPEKAKLKSFSAKIVQLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-GEF domain-containing family member 1A

Protein Size: 481

Purification: Affinity Purified

• Artikelnummer: AVIARP55468_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55468_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 221002
• Wirt: Rabbit