RASGEF1C Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RASGEF1C is the guanine nucleotide exchange factor (GEF).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RASGEF1C

Key Reference: Bonaldo,M.F., (1996) Genome Res. 6 (9), 791-806

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: FLELAKQVGEFITWKQVECPFEQDASITHYLYTAPIFSEDGLYLASYESE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-GEF domain-containing family member 1C

Protein Size: 466

Purification: Affinity Purified

• Artikelnummer: AVIARP55737_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55737_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 255426
• Wirt: Rabbit