English
RASSF7 Antibody - middle region : Biotin
RASSF7 Antibody - middle region : Biotin
Artikelnummer
AVIARP58122_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: The function remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RASSF7
Key Reference: Sherwood,V., (2008) Mol. Biol. Cell 19 (4), 1772-1782
Molecular Weight: 40kDa
Peptide Sequence: Synthetic peptide located within the following region: DISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKY
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Ras association domain-containing protein 7
Protein Size: 373
Purification: Affinity Purified
Description of Target: The function remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RASSF7
Key Reference: Sherwood,V., (2008) Mol. Biol. Cell 19 (4), 1772-1782
Molecular Weight: 40kDa
Peptide Sequence: Synthetic peptide located within the following region: DISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKY
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Ras association domain-containing protein 7
Protein Size: 373
Purification: Affinity Purified
| Artikelnummer | AVIARP58122_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58122_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 8045 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
