RB1 Antibody - middle region : FITC

RB1 Antibody - middle region : FITC
Artikelnummer
AVIARP58066_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a negative regulator of the cell cycle and was the first tumor suppressor gene found. The encoded protein also stabilizes constitutive heterochromatin to maintain the overall chromatin structure. The active, hypophospho

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RB1

Molecular Weight: 106kDa

Peptide Sequence: Synthetic peptide located within the following region: AEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Retinoblastoma-associated protein

Protein Size: 928

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58066_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58066_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5925
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×