RBJ Antibody - middle region : HRP

RBJ Antibody - middle region : HRP
Artikelnummer
AVIARP56938_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RBJ

Key Reference: von (2004) Gene 327 (2), 221-232

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: CVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DnaJ homolog subfamily C member 27

Protein Size: 273

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56938_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56938_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51277
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×