REM1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a GTPase and member of the RAS-like GTP-binding protein family. The encoded protein is expressed in endothelial cells, where it promotes reorganization of the actin cytoskeleton and morphological changes in the cells.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human REM1

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: SDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTP-binding protein REM 1

Protein Size: 298

Purification: Affinity Purified

• Artikelnummer: AVIARP54963_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54963_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 28954
• Wirt: Rabbit