RFPL3 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RFPL3

Key Reference: Rauch,T., (2006) Cancer Res. 66 (16), 7939-7947

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: VYTFRSVSAEEPLRPFLAPSIPPNGDQGVLSICPLMNSGTTDAPVRPGEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ret finger protein-like 3

Protein Size: 317

Purification: Affinity Purified

• Artikelnummer: AVIARP57945_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57945_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 10738
• Wirt: Rabbit