RHOF Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: RHOF is a plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. RHOF causes the formation of thin, actin-rich surface projections called filopodia. RHOF functions cooperatively with CDC42 and Rac

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RHOF

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: DNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYM

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Rho-related GTP-binding protein RhoF

Protein Size: 211

Purification: Affinity Purified

• Artikelnummer: AVIARP57310_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57310_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 54509
• Wirt: Rabbit