RNF5 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and altering the distribution and localization of paxillin in cytoplasm and cell focal adhesions.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RNF5

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: FPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 180

Purification: Affinity purified

• Artikelnummer: AVIARP58180_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58180_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 6048
• Wirt: Rabbit