RPIA Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Defects in RPIA are the cause of ribose 5-phosphate isomerase deficiency. The exact function of RPIA remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RPIA

Key Reference: Huck,J.H., (2004) Am. J. Hum. Genet. 74 (4), 745-751

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ribose-5-phosphate isomerase

Protein Size: 311

Purification: Affinity Purified

• Artikelnummer: AVIARP55438_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55438_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 22934
• Wirt: Rabbit