RPL37A Antibody - middle region : Biotin

RPL37A Antibody - middle region : Biotin
Artikelnummer
AVIARP56137_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pro

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPL37A

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 60S ribosomal protein L37a

Protein Size: 92

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56137_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56137_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6168
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×