RSPH10B Antibody - middle region : FITC

RSPH10B Antibody - middle region : FITC
Artikelnummer
AVIARP56027_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RSPH10B

Key Reference: Yang,P., J. Cell. Sci. 119 (PT 6), 1165-1174 (2006)

Molecular Weight: 96kDa

Peptide Sequence: Synthetic peptide located within the following region: EFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Radial spoke head 10 homolog B2

Protein Size: 870

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56027_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56027_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 222967
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×