SCAND2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. Functional studies have established that the SCAN box is a protein interaction domain that mediates both hetero- and homoprotein associations, and maybe involved in regulation of transcriptional activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SCAND2

Key Reference: 0

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: IQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Putative SCAN domain-containing protein 2

Protein Size: 152

Purification: Affinity Purified

• Artikelnummer: AVIARP58173_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58173_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 54581
• Wirt: Rabbit