Sec14l3 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Sec14l3 is a probable hydrophobic ligand-binding protein; It may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: RDQVKTQYEHSVQISRGSSHQVEYEILFPGCVLRWQFSSDGADIGFGVFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SEC14-like protein 3

Protein Size: 400

Purification: Affinity Purified

• Artikelnummer: AVIARP55733_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55733_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 64543
• Wirt: Rabbit