SEC14L4 Antibody - N-terminal region : FITC

SEC14L4 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55734_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SEC14L4 is a probable hydrophobic ligand-binding protein; may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids.The protein encoded by this gene is highly similar to the protein encoded by the Saccharomyces cerevisiae SEC14 gene. The SEC14 protein is a phophatidylinositol transfer protein that is essential for biogenesis of Golgi-derived transport vesicles, and thus is required for the export of yeast secretory proteins from the Golgi complex. The specific function of this protein has not yet been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SEC14L4

Key Reference: Mokashi,V., (2004) Biochem. Biophys. Res. Commun. 316 (3), 688-692

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SEC14-like protein 4

Protein Size: 406

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55734_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55734_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 284904
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×