Sec31a Antibody - N-terminal region : Biotin

Sec31a Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55111_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Sec31a is a putative membrane-associated endosomal phosphoprotein.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 136kDa

Peptide Sequence: Synthetic peptide located within the following region: DKEVVIAQKDKHTGPVRALDVNIFQTNLVASGANESEIYIWDLNNFATPM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein transport protein Sec31A

Protein Size: 1249

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55111_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55111_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 93646
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×