SENP5 Antibody - middle region : FITC

SENP5 Antibody - middle region : FITC
Artikelnummer
AVIARP55489_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins (see SUMO1; MIM 601912) is required for numerous biologic processes. SUMO-specific proteases, such as SENP5, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SENP5

Key Reference: Gong,L. (2006) J. Biol. Chem. 281 (23), 15869-15877

Molecular Weight: 87kDa

Peptide Sequence: Synthetic peptide located within the following region: LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sentrin-specific protease 5

Protein Size: 755

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55489_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55489_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 205564
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×