SERPINB8 Antibody - middle region : Biotin

SERPINB8 Antibody - middle region : Biotin
Artikelnummer
AVIARP57800_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The superfamily of high molecular weight serine proteinase inhibitors (serpins) regulate a diverse set of intracellular and extracellular processes such as complement activation, fibrinolysis, coagulation, cellular differentiation, tumor suppression, apoptosis, and cell migration. Serpins are characterized by well-conserved a tertiary structure that consists of 3 beta sheets and 8 or 9 alpha helices (Huber and Carrell, 1989 [PubMed 2690952]). A critical portion of the molecule, the reactive center loop connects beta sheets A and C. Protease inhibitor-8 (PI8; SERPINB8) is a member of the ov-serpin subfamily, which, relative to the archetypal serpin PI1 (MIM 107400), is characterized by a high degree of homology to chicken ovalbumin, lack of N- and C-terminal extensions, absence of a signal peptide, and a serine rather than an asparagine residue at the penultimate position (summary by Bartuski et al., 1997 [PubMed 9268635]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINB8

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: KAWTNSEKLTKSKVQVFLPRLKLEESYDLEPFLRRLGMIDAFDEAKADFS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serpin B8

Protein Size: 374

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57800_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57800_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5271
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×