SET Antibody - N-terminal region : FITC

SET Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56542_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SET is a multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone binding. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1. In the course of cytotoxic T-lymphocyte (CTL)-indu

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SET

Key Reference: Liu,Z., (2008) Mol. Cell 29 (6), 665-678

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cDNA, FLJ96345, Homo sapiens SET translocation (myeloid leukemia-associated) (SET),mRNA EMBL BAG37717.1

Protein Size: 277

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56542_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56542_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Immunoprecipitation, Western Blotting, Immunohistochemistry
Human Gene ID 6418
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×