SH3BP2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: SH3BP2 has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain. The protein binds to the SH3 domains of several proteins including the ABL1 and SYK protein tyrosine kinases, and functions as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations in this gene result in cherubism.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SH3BP2

Key Reference: Idowu,B.D., (2008) Br J Oral Maxillofac Surg 46 (3), 229-230

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: RQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SH3 domain-binding protein 2

Protein Size: 561

Purification: Affinity Purified

• Artikelnummer: AVIARP56546_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56546_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 6452
• Wirt: Rabbit