SLC18A1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The vesicular monoamine transporter acts to accumulate cytosolic monoamines into vesicles, using the proton gradient maintained across the vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC18A1

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: FKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWM

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Chromaffin granule amine transporter Ensembl ENSP00000428001

Protein Size: 385

Purification: Affinity Purified

• Artikelnummer: AVIARP58078_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58078_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 6570
• Wirt: Rabbit