SMUG1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: SMUG1 is a glycosylase that removes uracil from single- and double-stranded DNA in nuclear chromatin, thus contributing to base excision repair.SMUG1 is a glycosylase that removes uracil from single- and double-stranded DNA in nuclear chromatin, thus contributing to base excision repair.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SMUG1

Key Reference: Bethke,L., (2008) J. Natl. Cancer Inst. 100 (4), 270-276

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: IVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Single-strand selective monofunctional uracil DNA glycosylase

Protein Size: 270

Purification: Affinity Purified

• Artikelnummer: AVIARP55013_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55013_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23583
• Wirt: Rabbit