Sntg1 Antibody - N-terminal region : FITC

Sntg1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57299_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Sntg1 is an adapter protein that binds to and probably organizes the subcellular localization of a variety of proteins. It may link various receptors to the actin cytoskeleton and the dystrophin glycoprotein complex. It may participate in regulating the subcellular location of diacylglycerol kinase-zeta to ensure that diacylglycerol is rapidly inactivated following receptor activation.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: KLPVNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Gamma-1-syntrophin

Protein Size: 517

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57299_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57299_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 71096
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×