SPATA16 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SPATA16 is involved in the formation of sperm acrosome, which implicated its potential role in spermatogenesis and sperm-egg fusion. Defects in SPATA16 are a cause of globozoospermia; also called Round-headed spermatozoa.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPATA16

Key Reference: Dam,A.H., (2007) Am. J. Hum. Genet. 81 (4), 813-820

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: MDAGSSRSLENAVNRIYHDQLVPKINTSKKMSTLAHPPNILEMSQEIKKN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Spermatogenesis-associated protein 16

Protein Size: 569

Purification: Affinity Purified

• Artikelnummer: AVIARP58663_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58663_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 83893
• Wirt: Rabbit