SRR Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SRR catalyzes the synthesis of D-serine from L-serine.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SRR

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: GVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine racemase

Protein Size: 340

Purification: Affinity Purified

• Artikelnummer: AVIARP57572_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57572_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 63826
• Wirt: Rabbit