STAMBPL1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: STAMBPL1 is a zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains.STAMBPL1 does not cleave 'Lys-48'-linked polyubiquitin chains.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human STAMBPL1

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: AMSH-like protease

Protein Size: 436

Purification: Affinity Purified

• Artikelnummer: AVIARP57453_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57453_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 57559
• Wirt: Rabbit