STK38L Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: STK38L is involved in the regulation of structural processes in differentiating and mature neuronal cells.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human STK38L

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: PAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein kinase 38-like

Protein Size: 464

Purification: Affinity Purified

• Artikelnummer: AVIARP55142_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55142_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23012
• Wirt: Rabbit