Stxbp6 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Stxbp6 forms non-fusogenic complexes with SNAP25 and STX1A and may thereby modulate the formation of functional SNARE complexes and exocytosis.

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: SAISKEIFAPLDERMLGAIQVKRRTKKKIPFLATGGQGEYLTYICLSVTN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Syntaxin-binding protein 6

Protein Size: 210

Purification: Affinity Purified

• Artikelnummer: AVIARP54989_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54989_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 217517
• Wirt: Rabbit