English
SUSD3 Antibody - N-terminal region : HRP
SUSD3 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55443_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: The exact function of SUSD3 remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SUSD3
Key Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374
Molecular Weight: 27kDa
Peptide Sequence: Synthetic peptide located within the following region: LRLPPQATFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEW
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Sushi domain-containing protein 3
Protein Size: 255
Purification: Affinity Purified
Description of Target: The exact function of SUSD3 remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SUSD3
Key Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374
Molecular Weight: 27kDa
Peptide Sequence: Synthetic peptide located within the following region: LRLPPQATFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEW
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Sushi domain-containing protein 3
Protein Size: 255
Purification: Affinity Purified
| Artikelnummer | AVIARP55443_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55443_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Pig (Porcine), Cow (Bovine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 203328 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
