TBC1D7 Antibody - middle region : HRP

TBC1D7 Antibody - middle region : HRP
Artikelnummer
AVIARP56926_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TBC1D7 belongs to a family of proteins sharing a 180- to 200-amino acid TBC domain presumed to have a role in regulating cell growth and differentiation. These proteins share significant homology with TRE2, yeast Bub2, and CDC16.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TBC1D7

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: MYQLESGKLPRSPSFPLPKAFEQYLNLEDGRLLTHLRMCSAAPKLPYDLW

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: TBC1 domain family member 7

Protein Size: 247

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56926_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56926_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51256
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×