Tdrd7 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Tdrd7 binds to PCTAIRE 2, a Cdc2-related kinase expressed in the terminally differentiated neuron; contains five tudor-like domains; may mediate the regulation of mitochondrial function in the neurons.

Molecular Weight: 122kDa

Peptide Sequence: Synthetic peptide located within the following region: CSDCSIKVTKVDEARGVAYVYLFTPKNFPDPHRSINRQITNADLWKHQKD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tudor domain-containing protein 7

Protein Size: 1113

Purification: Affinity Purified

• Artikelnummer: AVIARP55002_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55002_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 85425
• Wirt: Rabbit