Tekt3 Antibody - N-terminal region : HRP

Tekt3 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57678_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Tekt3 is a structural component of ciliary and flagellar microtubules. It forms filamentous polymers in the walls of ciliary and flagellar microtubules. It is required for progressive sperm mobility.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Tekt3

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: NSSRHNSERLRVDTSRLIQDKYQQIRKTQAHSTQNLGERVNDLAFWKSEI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tektin-3

Protein Size: 490

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57678_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57678_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 71062
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×