Terf2ip Antibody - middle region : HRP

Terf2ip Antibody - middle region : HRP
Artikelnummer
AVIARP57301_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Terf2ip acts both as a regulator of telomere function and as a transcription regulator. It is involved in the regulation of telomere length and protection as a component of the shelterin complex (telosome). In contrast to other components of the shelterin complex, it is dispensible for telomere capping and does not participate in the protection of telomeres against non-homologous end-joining (NHEJ)-mediated repair. Instead, it is required to negatively regulate telomere recombination and is essential for repressing homology-directed repair (HDR), which can affect telomere length.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: LTYVKENARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRGQEHK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Telomeric repeat-binding factor 2-interacting protein 1

Protein Size: 286

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57301_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57301_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57321
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×