TEX11 Antibody - C-terminal region : FITC

TEX11 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP56160_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is X-linked and is expressed in only male germ cells. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TEX11

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: SLAAQFALENGQQIVAEKALEYLAQHSEDQEQVLTAVKCLLRFLLPKIAE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Testis-expressed sequence 11 protein

Protein Size: 615

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56160_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56160_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 56159
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×