TEX19 Antibody - middle region : HRP

TEX19 Antibody - middle region : HRP
Artikelnummer
AVIARP56004_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TEX19 is required during spermatogenesis and placenta development, probably by participating to the repression of retrotransposable elements and prevent their mobilization (By similarity). .

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TEX19

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: MEHTEAESEQEGSSGMELSWGQSPGQPVQGGSEAWGPGTLAAAPEGLEDA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Testis-expressed sequence 19 protein

Protein Size: 164

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56004_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56004_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 400629
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×