TEX45 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C19orf45

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: QALPGPPALRCKRASSGVELGDCKISYGSTCSEQKQAYRPQDLPEDRYDK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: testis-expressed protein 45

Protein Size: 491

Purification: Affinity Purified

• Artikelnummer: AVIARP55899_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55899_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Pig (Porcine), Dog (Canine), Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 374877
• Wirt: Rabbit